PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA02G0154300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 270aa    MW: 28648.2 Da    PI: 5.0453
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA02G0154300.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.8e-13170213447
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        WT eE+ ++++++  +G+g+Wk+ a+++ k+++  q+ s++qk+
  ORGLA02G0154300.1 170 WTREEHSQFLHGISAYGKGNWKALASEFVKTKSSTQIASHYQKF 213
                        ******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007173.12272IPR001005SANT/Myb domain
SuperFamilySSF466893.95E-62271IPR009057Homeodomain-like
CDDcd001670.004452666No hitNo description
PROSITE profilePS500905.3312670IPR017877Myb-like domain
PROSITE profilePS5129412.781162218IPR017930Myb domain
SuperFamilySSF466896.03E-14163219IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-9163217IPR009057Homeodomain-like
TIGRFAMsTIGR015577.4E-11165215IPR006447Myb domain, plants
SMARTSM007175.2E-8166216IPR001005SANT/Myb domain
PfamPF002494.8E-10170212IPR001005SANT/Myb domain
CDDcd001672.21E-8170213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MPTDDATATD NSDGATPCPA PLSSVWTRRD EKLLEMLLWR WQLDPHWDRV AAELGDKTAT  60
QAFDRYVCLA DELRLVMAAP AVDTPLAWDV QDEQVAAVAP LPGLEADAAA GAGESAEVTA  120
IGIAAAASPN AAATRAPTIG GGVELESREL KNPRKTRMAG GGPRKKAEMW TREEHSQFLH  180
GISAYGKGNW KALASEFVKT KSSTQIASHY QKFCIREEKR NLSKCKRASI HDIVSPTTTT  240
SAPESAGAGP SAPPCALIES GALIAGDDDA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624449.11e-156PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A0D3F5J60.0A0A0D3F5J6_9ORYZ; Uncharacterized protein
TrEMBLI1P0N70.0I1P0N7_ORYGL; Uncharacterized protein
STRINGORGLA02G0154300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144181825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.13e-18MYB family protein